PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626661.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 181aa    MW: 19867.5 Da    PI: 8.2084
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626661.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.27.7e-4512110199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+
  XP_013626661.1  12 PCAACKFLRRKCMPGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHRLQKELD 106
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_013626661.1 107 AANA 110
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.18311112IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-4412109IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MASSSSNTYN SPCAACKFLR RKCMPGCIFA PYFPPEEPHK FANVHKIFGA SNVTKLLNEL  60
LPHQREDAVN SLAYEAEARV RDPVYGCVGA ISYLQRQVHR LQKELDAANA DLVQYGLSTS  120
TPGNVVDLVF QPQPFPPQPL NPVYRLSGAS PVMTQQPRGT GGSYGTFLPW NNGHDQQGGN  180
M
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0082651e-171AB008265.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDC12.
GenBankAB1643051e-171AB164305.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like gene 4 protein, partial cds.
GenBankAB4738371e-171AB473837.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like 4 protein, complete cds.
GenBankAF4478971e-171AF447897.1 Arabidopsis thaliana LOBa (LOB) mRNA, complete cds; alternatively spliced.
GenBankBT0257451e-171BT025745.1 Arabidopsis thaliana At5g63090 mRNA, complete cds.
GenBankCP0026881e-171CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626660.11e-134PREDICTED: protein LATERAL ORGAN BOUNDARIES isoform X1
RefseqXP_013626661.11e-134PREDICTED: protein LATERAL ORGAN BOUNDARIES isoform X1
RefseqXP_013626662.11e-134PREDICTED: protein LATERAL ORGAN BOUNDARIES isoform X1
SwissprotQ9FML41e-124LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A078JMX61e-134A0A078JMX6_BRANA; BnaCnng60770D protein
TrEMBLA0A0D3BFI81e-134A0A0D3BFI8_BRAOL; Uncharacterized protein
STRINGBra038606.1-P1e-132(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-117LBD family protein